vncolella2006 vncolella2006

Today at 7:27 AM
Mathematics

Answered

cnklsnvsklfhnicspkaghnfpwstfryhdesuwiaqogtfyhdsujaiqo1234567890-=QWERTYUIOP[ASDFGHJKL;'ZXCVBNM,./
spain without the s

Answer :

BrainlyMastery BrainlyMastery

Today at 7:33 AM

Answer:

Bruh Lol

Step-by-step explanation:

Answer Link

beasyholli2 beasyholli2

Today at 7:32 AM

Answer:

spain without the s is pain!

Step-by-step explanation:

Answer Link

Other Questions

What is the value of the expression 9/14÷(−0.6×2)?

Define Gender Based Violence

What are the characteristics of the function f(x) = 2(x-4)5? O A. It is a reflection and a translation to the right of the parent function. O B. Both ends of th

What are the easiest injuries to avoid? Eye injuries Mouth injuries Knee injuries Wrist injuries

What is the value of the expression 9/14÷(−0.6×2)?

2. You.. not come with us it you don't want to. (need. can3. The spots on the bock of Aziz's carto be cleaned. ( need4. Tom will go from ....you come. (where, w

Do you agree with the poets view that it is futile to take pride in one's birth and state? Why / why not ?

he does my work change into negative

an Ink dot on a white porcelain dish appears dark. when the dish is raised to a very large temperature the dot appears brighter than the surroundings. why?

Describe briefly the three way in which individual with a particular traits may increase in population

Which inequalities describe the given graph? Select each correct answer. 3(4−x)<30 2/3x+9>5 −2(9−x)<−6 2x−5>7

Aside from low birthrates and high death rates, what can cause a country's population to decline? O A. emigration • B. increased food supplies • C. diffusion )

Why do you think Sergeant Clarence Williams is doubtful that any SS Troopers (Nazi Guards) will be taken prisoner at Dachau?

A rectangle is four times as long as it is wide. If it has an area of 36 square inches, what are its dimension?. a. 6 by 6 c. 4 by 9 b. 3 by 12 d. 4 and 8 Pleas

A frozen yogurt shop offers frozen yogurt in the sizes shown. The cost per cubic inch is $0.10 for each container’s contents. What is the difference between the

96 Eight small bricks have the same mass as three large bricks The mass of one small brick is 1.5kg. What is the mass of one large brick?

Manny and Susan have an egg carton full of eggs to use for their science project. Manny uses 1/3 of the eggs and Susan uses 1/2 of the eggs. Which fraction of t

I need help with these soon for the marking period

What defenses did Dachau have to prevent prisoners from escaping?

Identify the 17th term in the arithmetic sequence. a1 = 11, d = −2