mansion mansion

Today at 7:56 AM
Mathematics

Answered

What is the first step needed to solve (3/4)x-3=18

Answer :

Аноним Аноним

Today at 8:01 AM

add 3 to both sides of the equation

Answer Link

Other Questions

The number of ways of selecting 15 teams from 15 men and 15 women, such that each team consists of a man and a woman, is . a) 225 b) 210 c) 420 d) 375

commerce thrid samester monetary sub all multiple choice questions

write four qualities of a good student? for class 3rd

how do lakes become seasonal

find the following products and verify the results for text equal to -1 and Y equal to minus 2

suffix word for hunger

According to a national survey and a further update (Lenhart & others, 2015), which of the following is the primary way that most adolescents prefer to connect

The importance of evidence-based practice as a conceptual framework for evaluating and treating children and adolescents in psychiatry. Respond to at least one

Do husbands cheat on their wives more than wives cheat on their husbands? Suppose you take a group of 1000 randomly selected husbands and find that 231 cheated

Consider the limit along the line x=0, as y=0, as y=x. Therefore, (enter integers or fractions; enter DNE if the limit does not exist). a) The limit along x=0 i

For the peptide YALGIIQAQPDKSESELVSQIIEELIKKEK, predict the electrospray ionization mass spectrum. Assume that the molecular weight of the uncharged peptide is

write the equation of the line with slope of 2 and y-intercept of (0,15)

Your job-application letter is a chance to explain information not included on your resume, such as professional relationships you might have within the organiz

Used because it is not ethical to manipulate certain variables in an experiment (e.g., sunscreen). - No IV and no random assignment - Subject variables - factor

Could an employee make a disclaimer that they will use preferred pronouns but that doing so does mean they endorse any concept of gender identity that conflicts

A color-blind XX individual mates with an individual that is XY with normal color vision. Use a Punnett square to determine the expected offspring phenotypes an